PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538901.1_FGP028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 736aa    MW: 83470.9 Da    PI: 8.1372
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538901.1_FGP028genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.75.2e-1113557281374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+av++++   a++l++++++++spdgd++qRla+y++ +L+arla+ +s++y++l +s+ts    ++ l+a++l+  ++P+ +
  KN538901.1_FGP028 355 LRNLLIHCAQAVAADNRISASELVKKIRQHSSPDGDSNQRLAFYLVDGLEARLAGIGSQVYRKLMASRTS---AESLLKAYSLYLSACPFER 443
                        689*************************************************************999998...89999************** PP

               GRAS  93 fshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         s+  aN++Il+a +g+  ++vHi+ f+i  G+QWp+L+q La+ ++gpp+lRiTg++ p++g    e +eetg+rLa++A+ ++vpf+++ 
  KN538901.1_FGP028 444 ASFAYANRTILDASKGQqpRKVHIVHFGICAGFQWPSLIQRLANEEGGPPKLRITGIDMPQPGfhPCEIIEETGKRLADYANLFKVPFQYQG 535
                        *****************999******************************************9999999*********************** PP

               GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +a+r+e++++e+L+++++E+l+Vn+++++++l de vs++s+rd+vLk+++ ++P+v+++   + +++s+ F +rf e l ++s+lfd+++
  KN538901.1_FGP028 536 -IASRWETVQIEDLNIDKDEVLIVNCMFRMKNLGDEMVSMNSARDRVLKIMRMMNPRVFILGIVNGSYSSPFFITRFKEVLFHFSSLFDMID 626
                        .7****************************************************************************************** PP

               GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                        a++pr++e+r+++Er l+g+e+ n++acegaer+er e++++W++r  +aGFk++p++ ++ k++  + + ++ + +  +e+ g+l++gWk+
  KN538901.1_FGP028 627 ANVPRDNEARKMIERGLFGQEALNIIACEGAERTERPESYKQWQARCLKAGFKQLPVDPDTLKKIINMKKGIYHEDFVADEDGGWLLQGWKG 718
                        *************************************************************************999**************** PP

               GRAS 365 rpLvsvSaWr 374
                        r ++++S W+
  KN538901.1_FGP028 719 RVIYAISTWK 728
                        *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.501329708IPR005202Transcription factor GRAS
PfamPF035141.8E-108355728IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MVIELPFDNQ YTTTETEQPH DGSSCSSQQQ LSLYNYSPSD PQLFSQPTTG SRTYLSGAVT  60
IPGICNDKSN LGQPQFQIGA GVSLEYQRIR SSDALCYISR MLMEDVDERV DLYQGEAALQ  120
AAEKPFYDIL GQVYPPSLNR LELHSANEPD TPDESSSRNN YHNRYHSSHS NFNMLQPSPA  180
PLSPYSYGRS LFLPNQNLVS TAWTSTFGIP GFQIRRGAEE AKRFVPIIDK LVIDLDTERG  240
LSISKMTMKA KVGDKKRYAI FEVTDQRHSP YTTDLDILEG RNSKRYSITY CEIIRNDMFD  300
RVLLCYGVEN FAEASNLRRI MMKQASKNSL NGQTRGSAQQ KLRGKKQLKK DVVDLRNLLI  360
HCAQAVAADN RISASELVKK IRQHSSPDGD SNQRLAFYLV DGLEARLAGI GSQVYRKLMA  420
SRTSAESLLK AYSLYLSACP FERASFAYAN RTILDASKGQ QPRKVHIVHF GICAGFQWPS  480
LIQRLANEEG GPPKLRITGI DMPQPGFHPC EIIEETGKRL ADYANLFKVP FQYQGIASRW  540
ETVQIEDLNI DKDEVLIVNC MFRMKNLGDE MVSMNSARDR VLKIMRMMNP RVFILGIVNG  600
SYSSPFFITR FKEVLFHFSS LFDMIDANVP RDNEARKMIE RGLFGQEALN IIACEGAERT  660
ERPESYKQWQ ARCLKAGFKQ LPVDPDTLKK IINMKKGIYH EDFVADEDGG WLLQGWKGRV  720
IYAISTWKPN ESYLDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-503597288375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693385.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 9
TrEMBLB8AWY40.0B8AWY4_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA018950-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-161GRAS family protein